Langsung ke konten utama

POLIMERASE CHAIN REACTION

BIOTEKNOLOGI
POLIMERASE CHAIN REACTION

Disusun Guna Memenuhi Tugas Mata Kuliah Bioteknologi


Disusun Oleh :
Hafidha Asni Akmalia                     
08304241003
Pendidikan Biologi Reguler



JURUSAN PENDIDIKAN BIOLOGI
FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM
UNIVERSITAS NEGERI YOGYAKARTA
2011

Musa ABB Group isolate YX-03 resistance protein gene, partial cds
GenBank: HQ199836.1
LOCUS       HQ199836                 689 bp    DNA     linear   PLN 15-FEB-2011
DEFINITION  Musa ABB Group isolate YX-03 resistance protein gene, partial cds.
ACCESSION   HQ199836
VERSION     HQ199836.1  GI:323135508
KEYWORDS    .
SOURCE      Musa ABB Group
  ORGANISM  Musa ABB Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Zingiberales; Musaceae;
            Musa; Eumusa.
REFERENCE   1  (bases 1 to 689)
  AUTHORS   Lu,Y., Zhang,X., Qi,Y., Pu,J., Xie,Y., Lv,Y. and Zhang,H.
  TITLE     Cloning and Characterization of Resistance Gene Homologs Isolated
            from Banana
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 689)
  AUTHORS   Lu,Y., Zhang,X., Qi,Y., Pu,J., Xie,Y., Lv,Y. and Zhang,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-AUG-2010) Environment and Plant Protection Institute,
            Tropical Agricultural Sciences, Baodao Xincun, Danzhou, Hainan
            571737, P.R. China
FEATURES             Location/Qualifiers
     source          1..689
                     /organism="Musa ABB Group"
                     /mol_type="genomic DNA"
                     /isolate="YX-03"
                     /db_xref="taxon:214693"
     mRNA            <1..>689
                     /product="resistance protein"
     CDS             <1..>689
                     /note="R protein"
                     /codon_start=2
                     /product="resistance protein"
                     /protein_id="ADX31660.1"
                     /db_xref="GI:323135509"
                     /translation="FLVLDDVWDAQIWDDLLRNPLQGGAAGSRVLVTTRNAGIARQMK
                     AAHVHEMKLLPPEDGWSLLCKKATMNAEEERDAQDLKDTGMKIVDKCGGLPLAIKTIG
                     GVLCSRGLNRSAWEEVLRSAAWSRTGLPEGVHGALNLSYQDLPSHLKQCFLYCALFKE
                     DYVFDRPEIVRLWIAEGFVEARGDVSLEETGEQYYRELLHRSLLQWQSYSLDDYYEYF
                     KMHDLVHDLAE"
 

 
 
ORIGIN      
       1  cttcctggtg ctggatgatg tctgggatgc tcagatctgg gacgacttgc tccgcaatcc
       61 tttgcaggga ggagcagcag gcagcagggt gctggtgaca accagaaacg cagggatcgc
      121 gaggcaaatg aaggcggccc acgtccacga gatgaagctg ctgcctccgg aggatggctg
      181 gtccctcctg tgcaagaagg cgacgatgaa tgcagaggag gaaagggatg cccaagatct
      241 caaggacaca ggcatgaaga ttgttgacaa atgcggaggg cttcccctgg ccatcaagac
      301 catcggaggg gtcctctgct ccagaggact caacagaagt gcgtgggagg aagttctccg
      361 cagcgccgca tggtcacgga ccgggcttcc cgaaggtgtg cacggagcac tgaatctgag
      421 ctaccaagac ttgccgtccc atctcaagca atgctttctc tactgtgcct tgttcaaaga
      481 agactatgtg tttgacaggc ctgaaatcgt cagattatgg atagccgagg ggtttgtcga
      541 agcacgagga gatgtcagct tggaggaaac aggggagcaa tattatagag agctgcttca
      601 taggagcctt ttacaatggc aaagttacag tctggacgac tactatgagt atttcaagat
      661 gcacgacctc gtgcacgact tggccgaat



5’                                                                                                                                 3’

cttcctggtgctggatgatgtctgggatgctcagatctgggacgacttgctccgcaatcctttgcaggga 
ggagcagcaggcagcagggtgctggtgacaaccagaaacgcagggatcgcgaggcaaatgaagg
cggcccacgtccacgagatgaagctgctgcctcc

Primers

  1. Primer Forward
cttcctggtgctggatgatgt  
Tm :     4 (g + c) + 2 (a + t)
            4 (7 + 4) + 2 (2 + 8)
            4(11) + 2 (10)
            44 + 20
            64˚C
  1. Primer Reverse
ggaggcagcagcttcatctcg
Tm :     4 (g + c) + 2 (a + t)
            4 (7 + 6) + 2 (4 + 4)
            4 (13) + 2 (8)
            52 + 16
            68˚C   
Selisih suhu Tm primer Forward dan Reverse
= 68˚C - 64˚C
= 4˚C
  1. Panjang PCR produk
168 bp

Komentar

Postingan populer dari blog ini

MEKANISME KONTRAKSI DAN RELAKSASI OTOT

Filamen aktin biasanya berhubungan dengan myosin yang mana bertanggung jawab untuk berbagai pergerakan sel. Myosin adalah prototipe dari penggerak molekuler - sebuah protein yang mengubah energi kimia dalam bentuk ATP menjadi energi gerak yang menghasilkan kekuatan dan pergerakan. Kebanyakan pergerakan umumnya adalah kontraksi otot yang memberi model untuk memahami interaksi aktin dan myosin dan aktivitas penggerak dari molekul myosin. Bagaimanapun juga, interaksi aktin dan myosin tidak hanya bertanggung jawab pada kontraksi otot tetapi juga untuk berbagai pergerakan sel non otot termasuk pembelahan sel. Sehingga interaksi diataranya memerankan peran yang penting di biologi sel. Lebih jauh, sitoskeleton aktin bertanggung jawab untuk pergerakan lambat sel menyeberangi permukaan yang terlihat digerakkan secara langsung oleh polimerisasi aktin dengan baik oleh intreaksi aktin - myosin. 1.Pendahuluan Sel otot merupakan sel yang terspesialisasi untuk satu tugas, kontraksi dan spesialisasi in…

PERKECAMBAHAN SERBUK SARI

LAPORAN PRAKTIKUM REPRODUKSI DAN EMBRIOLOGI TUMBUHAN PERKECAMBAHAN SERBUK SARI
Disusun Oleh : Kelompok 4 Pendidikan Biologi Subsidi 1.Hafidha Asni Akmalia            (08304241003) 2.Tuttus Sufi Kusuma LPS.       (08304241022) 3.Riza Sativani Hayati   (08304241029) 4.Nur Hidayah                           (08304241030) 5.Titis Nindiasari A.                   (08304241036)


JURUSAN PENDIDIKAN BIOLOGI FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM UNIVERSITAS NEGERI YOGYAKARTA 2010 A.TUJUAN Mengamati serbuk sari yang berkecambah secara in vitro
B.DASAR TEORI Serbuk sari (pollen grain) adalah sebuah sel hidup yang berisi sel kelamin jantan pada bunga (mempunyai protoplasma) yang terbungkus oleh dinding sel. Dinding serbuk sari terdiri atas dua lapisan yaitu di bagian luar yang tebal dan keras disebut lapisan eksin dan sebelah dalam tipis seperti selaput disebut  intin. Pada permukaan eksin terdapat celah atau pori yang disebut apertura yang dapat digunakan oleh serbuk sari untuk jalan keluarnya buluh serbuk …

PERAN ORGANISME DALAM PROSES PEMBENTUKAN DAN PERKEMBANGAN TANAH

MAKALAH BIOLOGI TANAH PERAN ORGANISME DALAM PROSES PEMBENTUKAN DAN PERKEMBANGAN TANAH Disusun Guna Memenuhi Tugas Mata Kuliah Biologi Tanah






Disusun Oleh : Hafidha Asni Akmalia                08304241003 Alfiah Nurul Wahidah                 08304241019 Muhammad Radian N.A.            08304241034



JURUSAN PENDIDIKAN BIOLOGI FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM UNIVERSITAS NEGERI YOGYAKARTA 2011

BAB I PENDAHULUAN
A.Latar Belakang Tanah sangat vital peranannya bagi semua kehidupan di bumi karena tanah mendukung kehidupan tumbuhan dengan menyediakan hara dan air sekaligus sebagai penopang akar. Struktur tanah yang berongga-rongga juga menjadi tempat yang baik bagi akar untuk bernafas dan tumbuh. Tanah juga menjadi habitat hidup berbagai mikroorganisme. Bagi sebagian besar hewan darat, tanah menjadi lahan untuk hidup dan bergerak. Tanah berasal dari pelapukan batuan dengan bantuan organisme, membentuk tubuh unik yang menutupi batuan. Proses pembentukan tanah dikenal sebagai pedogenesis. Proses yan…