Langsung ke konten utama

POLIMERASE CHAIN REACTION

BIOTEKNOLOGI
POLIMERASE CHAIN REACTION

Disusun Guna Memenuhi Tugas Mata Kuliah Bioteknologi


Disusun Oleh :
Hafidha Asni Akmalia                     
08304241003
Pendidikan Biologi Reguler



JURUSAN PENDIDIKAN BIOLOGI
FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM
UNIVERSITAS NEGERI YOGYAKARTA
2011

Musa ABB Group isolate YX-03 resistance protein gene, partial cds
GenBank: HQ199836.1
LOCUS       HQ199836                 689 bp    DNA     linear   PLN 15-FEB-2011
DEFINITION  Musa ABB Group isolate YX-03 resistance protein gene, partial cds.
ACCESSION   HQ199836
VERSION     HQ199836.1  GI:323135508
KEYWORDS    .
SOURCE      Musa ABB Group
  ORGANISM  Musa ABB Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Zingiberales; Musaceae;
            Musa; Eumusa.
REFERENCE   1  (bases 1 to 689)
  AUTHORS   Lu,Y., Zhang,X., Qi,Y., Pu,J., Xie,Y., Lv,Y. and Zhang,H.
  TITLE     Cloning and Characterization of Resistance Gene Homologs Isolated
            from Banana
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 689)
  AUTHORS   Lu,Y., Zhang,X., Qi,Y., Pu,J., Xie,Y., Lv,Y. and Zhang,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-AUG-2010) Environment and Plant Protection Institute,
            Tropical Agricultural Sciences, Baodao Xincun, Danzhou, Hainan
            571737, P.R. China
FEATURES             Location/Qualifiers
     source          1..689
                     /organism="Musa ABB Group"
                     /mol_type="genomic DNA"
                     /isolate="YX-03"
                     /db_xref="taxon:214693"
     mRNA            <1..>689
                     /product="resistance protein"
     CDS             <1..>689
                     /note="R protein"
                     /codon_start=2
                     /product="resistance protein"
                     /protein_id="ADX31660.1"
                     /db_xref="GI:323135509"
                     /translation="FLVLDDVWDAQIWDDLLRNPLQGGAAGSRVLVTTRNAGIARQMK
                     AAHVHEMKLLPPEDGWSLLCKKATMNAEEERDAQDLKDTGMKIVDKCGGLPLAIKTIG
                     GVLCSRGLNRSAWEEVLRSAAWSRTGLPEGVHGALNLSYQDLPSHLKQCFLYCALFKE
                     DYVFDRPEIVRLWIAEGFVEARGDVSLEETGEQYYRELLHRSLLQWQSYSLDDYYEYF
                     KMHDLVHDLAE"
 

 
 
ORIGIN      
       1  cttcctggtg ctggatgatg tctgggatgc tcagatctgg gacgacttgc tccgcaatcc
       61 tttgcaggga ggagcagcag gcagcagggt gctggtgaca accagaaacg cagggatcgc
      121 gaggcaaatg aaggcggccc acgtccacga gatgaagctg ctgcctccgg aggatggctg
      181 gtccctcctg tgcaagaagg cgacgatgaa tgcagaggag gaaagggatg cccaagatct
      241 caaggacaca ggcatgaaga ttgttgacaa atgcggaggg cttcccctgg ccatcaagac
      301 catcggaggg gtcctctgct ccagaggact caacagaagt gcgtgggagg aagttctccg
      361 cagcgccgca tggtcacgga ccgggcttcc cgaaggtgtg cacggagcac tgaatctgag
      421 ctaccaagac ttgccgtccc atctcaagca atgctttctc tactgtgcct tgttcaaaga
      481 agactatgtg tttgacaggc ctgaaatcgt cagattatgg atagccgagg ggtttgtcga
      541 agcacgagga gatgtcagct tggaggaaac aggggagcaa tattatagag agctgcttca
      601 taggagcctt ttacaatggc aaagttacag tctggacgac tactatgagt atttcaagat
      661 gcacgacctc gtgcacgact tggccgaat



5’                                                                                                                                 3’

cttcctggtgctggatgatgtctgggatgctcagatctgggacgacttgctccgcaatcctttgcaggga 
ggagcagcaggcagcagggtgctggtgacaaccagaaacgcagggatcgcgaggcaaatgaagg
cggcccacgtccacgagatgaagctgctgcctcc

Primers

  1. Primer Forward
cttcctggtgctggatgatgt  
Tm :     4 (g + c) + 2 (a + t)
            4 (7 + 4) + 2 (2 + 8)
            4(11) + 2 (10)
            44 + 20
            64˚C
  1. Primer Reverse
ggaggcagcagcttcatctcg
Tm :     4 (g + c) + 2 (a + t)
            4 (7 + 6) + 2 (4 + 4)
            4 (13) + 2 (8)
            52 + 16
            68˚C   
Selisih suhu Tm primer Forward dan Reverse
= 68˚C - 64˚C
= 4˚C
  1. Panjang PCR produk
168 bp

Komentar

Postingan populer dari blog ini

MEKANISME KONTRAKSI DAN RELAKSASI OTOT

Filamen aktin biasanya berhubungan dengan myosin yang mana bertanggung jawab untuk berbagai pergerakan sel. Myosin adalah prototipe dari penggerak molekuler - sebuah protein yang mengubah energi kimia dalam bentuk ATP menjadi energi gerak yang menghasilkan kekuatan dan pergerakan. Kebanyakan pergerakan umumnya adalah kontraksi otot yang memberi model untuk memahami interaksi aktin dan myosin dan aktivitas penggerak dari molekul myosin. Bagaimanapun juga, interaksi aktin dan myosin tidak hanya bertanggung jawab pada kontraksi otot tetapi juga untuk berbagai pergerakan sel non otot termasuk pembelahan sel. Sehingga interaksi diataranya memerankan peran yang penting di biologi sel. Lebih jauh, sitoskeleton aktin bertanggung jawab untuk pergerakan lambat sel menyeberangi permukaan yang terlihat digerakkan secara langsung oleh polimerisasi aktin dengan baik oleh intreaksi aktin - myosin. 1.Pendahuluan Sel otot merupakan sel yang terspesialisasi untuk satu tugas, kontraksi dan spesialisasi in…

LAPORAN PRAKTIKUM MIKROMETRI

LAPORAN PRAKTIKUM MIKROTEKNIK DAN TEKNIK LABORATORIUM
MIKROMETRI


Disusun oleh : 1.Zulqarnain Assiddiqqi      (08304241001) 2.Shaim Basyari                  (08304241002) 3.Hafidha Asni Akmalia      (08304241003) 4.Febrianawati Yusup         (08304241004) 5.Dian Fita Lestari               (08304241005)


JURUSAN PENDIDIKAN BIOLOGI FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM UNIVERSITAS NEGERI YOGYAKARTA 2011

MIKROMETRI
A.TUJUAN Mengukur diameter serbuk sari. B.DASAR TEORI Mikroskop merupakan alat bantu penglihatan untuk melihat benda-benda yang sangat kecil yang tak mampu dilihat oleh mata dengan jelas. Mikroskop cahaya merupakan mikroskop yang paling sederhana dimana dalam penggunaannya membutuhkan cahaya agar spesimen yang akan dilihat dapat dilihat dengan jelas. Mikroskop cahayaterbaik mampu memperbesar benda 2000 kali. Saat ahli biologi melihat sebuah spesimen lewat mikroskop cahaya, bukan hanya mereka tertarik dengan bentuk dan detailnya, namun juga ukurannya. Satuan pengukuran yang dipakai mikro…

MIKROSKOP MEDAN TERANG

BRIGHT FIELD MICROSCOPE (MIKROSKOP MEDAN TERANG) Disusun Guna Memenuhi Tugas Mata Kuliah Mikrobiologi







Disusun Oleh : 1.Hafidha Asni Akmalia            (08304241003) 2.Liedya Kusuma Ratih            (08304241023)




JURUSAN PENDIDIKAN BIOLOGI FAKULTAS MATEMATIKA DAN ILMU PENGETAHUAN ALAM UNIVERSITAS NEGERI YOGYAKARTA 2010
BRIGHT FIELD MICROSCOPE (MIKROSKOP MEDAN TERANG)


A.Latar Belakang.
Antony Van Leuwenhoek orang yang pertama kali menggunakan mikroskop walaupan dalam bentuk sederhana pada bidang mikrobiologi. Kemudian pada tahun 1600 Hanz dan Z Jensen telah menemukan mikroskop yang lebih maju dengan nama mikroskop ganda. Mikroskop adalah suatu benda yang berguna untuk memberikan bayangan yang diperbesar dari benda-benda yang terlalu kecil untuk dilihat dengan mata telanjang. Mikroskop terdiri dari beberapa bagian yang memiliki fungsi masing-masing. Mikroskop pada prinsipnya terdiri dari dua lensa cembung yaitu sebagai lensa objektif (dekat dengan mata) dan lensa okuler (dekat dengan benda). Baik o…